PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g01960.2.p
Common NameBRADI_2g01960, LOC100827361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 358aa    MW: 40066.9 Da    PI: 6.8351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g01960.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-1759106148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+WT eEd ll  +++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Bradi2g01960.2.p  59 RGPWTLEEDNLLMSYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 106
                       89********************************************97 PP

2Myb_DNA-binding53.27e-17112155146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T+eE++l++++++++G++ W++Ia++++ gRt++++k++w++
  Bradi2g01960.2.p 112 RGNLTAEEQLLILELHAKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 155
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.59954106IPR017930Myb domain
SuperFamilySSF466893.18E-3057153IPR009057Homeodomain-like
SMARTSM007172.2E-1358108IPR001005SANT/Myb domain
PfamPF002498.7E-1559106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2360113IPR009057Homeodomain-like
CDDcd001673.39E-1061106No hitNo description
PROSITE profilePS5129426107161IPR017930Myb domain
SMARTSM007171.8E-15111159IPR001005SANT/Myb domain
PfamPF002491.3E-15112155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-23114160IPR009057Homeodomain-like
CDDcd001675.97E-12116155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MLVPYLSIYY YKRLKGAAPS KGFIFDRSYS FIETTRWPTM SRPRKAAMEE EDSSTELRRG  60
PWTLEEDNLL MSYIACHGEG RWNLLARCSG LKRTGKSCRL RWLNYLKPDI KRGNLTAEEQ  120
LLILELHAKW GNRWSRIAQH LPGRTDNEIK NYWRTRVQKQ ARQLNVDANS PVFRDAVRCY  180
WMPRLLDSQY MAAFQAQAQA AHTPESGTTM QMQQQEQQYN CCYPVENHSP STATASTSGG  240
GGGEMATAAM QQQQQAAVLP VPCFSELNWD LDDYPAAAML GSSCLGLDGL DLGPAQAHEA  300
DSTATLLDYV NHSSFTYNHM NYYYCGGAMD DDGGDHLLHG STTSAARKLG EWGSGGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26561604107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0634291e-119BT063429.1 Zea mays full-length cDNA clone ZM_BFc0062O06 mRNA, complete cds.
GenBankKJ7275791e-119KJ727579.1 Zea mays clone pUT5439 MYB transcription factor (MYB137) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754278.10.0PREDICTED: transcription factor AS1-like
TrEMBLA0A0Q3QM170.0A0A0Q3QM17_BRADI; Uncharacterized protein
STRINGBRADI2G01960.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.17e-76myb domain protein 62